Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein |
---|---|
Uniprot ID | Q96EM0 |
Uniprot link | http://www.uniprot.org/uniprot/Q96EM0 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLDDDDKMESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRR LMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCGLVTA FVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVTEAVK AQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATG SVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK |
Molecular weight | 40,05 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, imidazole 300mM, pH7.4 if native conditions. PBS, imidazole 10mM, Urea 8M if denaturing conditions |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | NP_653182.1 |
Spec:Entrez GeneID | 112849 |
Spec:NCBI Gene Aliases | C14orf149 |
Spec:SwissProtID | Q96EM0 |
NCBI Reference | NP_653182.1 |
Aliases /Synonyms | ORF149, trans-L-3-hydroxyproline dehydratase (Former Proline racemase) |
Reference | PX-P1134 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.