Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein |
---|---|
Uniprot ID | Q15661 |
Uniprot link | http://www.uniprot.org/uniprot/Q15661 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPGSHHHHHH |
Molecular weight | 31.23 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | NaCl 150mM, Tris-HCl 50 mM, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Full-length |
NCBI Reference | Q15661 |
Aliases /Synonyms | TPSAB1, Tryptase Alpha/Beta 1, Tryptase Alpha II, Tryptase Beta I, Tryptase-I, Tryptase-II, Tryptase-III,Tryptase, TPS |
Reference | PX-P3015 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.