Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein |
---|---|
Uniprot ID | Q7Z7D3 |
Uniprot link | http://www.uniprot.org/uniprot/Q7Z7D3 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH |
Molecular weight | 28.73kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 70% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Partial |
Aliases /Synonyms | B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1 |
Reference | PX-P4045 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.