Name: ICOS Protein - Human CD278 Recombinant Protein
SKU: PX-P4035-10
Availability: InStock

Product name	ICOS Protein - Human CD278 Recombinant Protein
Uniprot ID	Q9Y6W8
Uniprot link	http://www.uniprot.org/uniprot/Q9Y6W8
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	42.34kDa
Protein delivered with Tag?	Yes
Purity estimated	70%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Partial
Aliases /Synonyms	CD278, AILIM, Inducible T-Cell Costimulator, Activation-Inducible Lymphocyte Immunomediatory Molecule
Reference	PX-P4035
Note	For research use only

No Products found