Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vopratelimab Biosimilar – Anti-ICOS, CD278 mAb – Research Grade

  • PX-TA1505-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade

Product name Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1505-50
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Vopratelimab Biosimilar, also known as Anti-ICOS or CD278 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. This biosimilar is a research grade product that has been designed to mimic the structure and function of the original Vopratelimab antibody. In this article, we will provide a detailed description of the structure, activity, and potential applications of Vopratelimab Biosimilar.

Structure of Vopratelimab Biosimilar

Vopratelimab Biosimilar is a monoclonal antibody that targets the immune checkpoint protein ICOS (Inducible T cell CO-Stimulator). It is a fully humanized antibody, meaning that it is derived from human cells and has a high affinity for its target. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL).

The variable domains of Vopratelimab Biosimilar are responsible for binding to the ICOS protein. These domains contain complementarity-determining regions (CDRs) that interact with specific amino acid sequences on the target protein. The constant domains, on the other hand, are responsible for the effector functions of the antibody, such as activating immune cells and triggering cell death in target cells.

Activity of Vopratelimab Biosimilar

Vopratelimab Biosimilar works by blocking the interaction between ICOS and its ligand, B7-H2. This interaction is crucial for the activation and proliferation of T cells, which are important components of the immune system. By inhibiting this interaction, Vopratelimab Biosimilar can regulate the activity of T cells and prevent excessive immune responses.

In addition to its inhibitory effect on T cells, Vopratelimab Biosimilar also has the ability to activate other immune cells, such as natural killer (NK) cells and macrophages. This can enhance the immune response against cancer cells and infectious agents. Furthermore, the antibody can induce cell death in target cells through the activation of the complement system and antibody-dependent cellular cytotoxicity (ADCC).

Applications of Vopratelimab Biosimilar

Vopratelimab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, including cancer and autoimmune disorders. As an immune checkpoint inhibitor, it can be used in combination with other therapies to enhance their efficacy. In cancer treatment, Vopratelimab Biosimilar can be used to block the immunosuppressive effects of ICOS, allowing for a stronger immune response against tumor cells.

Furthermore, Vopratelimab Biosimilar has the potential to be used as a therapeutic agent for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. By inhibiting the activity of T cells, it can help regulate the immune response and prevent the destruction of healthy tissues.

Conclusion

Vopratelimab Biosimilar, also known as Anti-ICOS or CD278 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. Its structure, activity, and potential applications make it a promising candidate for the treatment of cancer and autoimmune disorders. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar.

SEC-HPLC of Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

SEC-HPLC of Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Flow Cytometry results for Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vopratelimab Biosimilar – Anti-ICOS, CD278 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products