Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Interleukin-1 alpha(IL1A) |
|---|---|
| Uniprot ID | P01583 |
| Uniprot link | http://www.uniprot.org/uniprot/P01583 |
| Expression system | Prokaryotic expression |
| Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Molecular weight | 19.2kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 50 mM Tris-HCl pH 8.0, 150 mM NaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser113-Ala271 |
| Aliases /Synonyms | IL1F1,Hematopoietin-1 |
| Reference | PX-P4588 |
| Note | For research use only |
The protein encoded by this gene is a member of the interleukin-1 cytokine family. This cytokine is a pleiotropic cytokine involved in a variety of immune responses, inflammatory processes and hematopoiesis. The cytokine is produced by monocytes and macrophages in the form of proprotein, which is proteolytically processed and released in response to cell damage, thereby inducing apoptosis. This gene and 8 other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been shown that these gene polymorphisms are related to rheumatoid arthritis and Alzheimer’s disease.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.