Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Interleukin-10 recombinant protein |
|---|---|
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNLEHHHHHH |
| Molecular weight | 17.71 kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Ser19-Asn178 |
| Protein Accession | P22301 |
| Aliases /Synonyms | IL-10,Cytokine synthesis inhibitory factor,CSIF |
| Reference | PX-P5130 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.