Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Interleukin-10 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Molecular weight:
17.71 kDa

$500.00

100ug + 500 loyalty points
Ser19–Asn178 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-10 recombinant protein

Interleukin-10 recombinant protein

Product name Interleukin-10 recombinant protein
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNLEHHHHHH
Molecular weight 17.71 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser19-Asn178
Protein Accession P22301
Aliases /Synonyms IL-10,Cytokine synthesis inhibitory factor,CSIF
Reference PX-P5130
Note For research use only
Background information Array
Molecular Constructor
Ser19–Asn178 His

There are no reviews yet.

Be the first to review “Interleukin-10 recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products