Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade

Uniprot ID:
P22301

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade

Product name PX-TA2162-50
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10
Product name Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10
Product name Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade
Uniprot ID P22301
Source CAS: 2771192-33-5
Expression system XtenCHO
Raw Antigen Sequence MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2162
Note For research use only. Not suitable for human use.
Isotype Vibrio cholerae L-methionyl-cholix toxin fragment fused to human IL10

Introduction to Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade

Vimekofusp Biosimilar, also known as Anti-IL-10 monoclonal antibody (mAb), is a research grade therapeutic antibody that has been developed to target the cytokine Interleukin-10 (IL-10). This biosimilar has been designed to mimic the structure and function of the original Vimekofusp, a drug used for the treatment of certain types of cancer. In this article, we will explore the structure, activity, and potential applications of Vimekofusp Biosimilar as a research tool.

Structure of Vimekofusp Biosimilar

Vimekofusp Biosimilar is a recombinant monoclonal antibody that is produced in a laboratory using genetic engineering techniques. It is derived from the original Vimekofusp, which is a chimeric antibody made up of both human and mouse components. The biosimilar version, however, is fully humanized, meaning it is composed entirely of human antibody sequences. This modification is intended to reduce the risk of adverse reactions and increase the effectiveness of the drug.

The antibody consists of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. These chains are made up of amino acids, the building blocks of proteins, and are arranged in a specific sequence to form the unique structure of the antibody. The structure of Vimekofusp Biosimilar is crucial for its ability to bind to its target, IL-10, and exert its therapeutic effects.

Activity of Vimekofusp Biosimilar

Vimekofusp Biosimilar works by binding to IL-10, a cytokine that plays a critical role in regulating the immune response. IL-10 is produced by various cells in the body, including immune cells, and is known to have both pro- and anti-inflammatory effects. In certain types of cancer, IL-10 can promote tumor growth and suppress the immune system, making it an attractive therapeutic target.

By binding to IL-10, Vimekofusp Biosimilar blocks its activity and prevents it from exerting its effects. This can help to restore the balance of the immune system and potentially inhibit tumor growth. Additionally, Vimekofusp Biosimilar has been shown to enhance the activity of other immune cells, such as natural killer cells, which can further aid in fighting cancer.

Title: Potential Applications of Vimekofusp Biosimilar

Vimekofusp Biosimilar has shown promising results in preclinical studies as a potential treatment for various types of cancer, including lymphoma and leukemia. It has also been investigated as a potential therapy for autoimmune diseases, such as Crohn’s disease and rheumatoid arthritis, where IL-10 plays a role in the pathogenesis.

Aside from its potential therapeutic applications, Vimekofusp Biosimilar can also be used as a research tool to study the role of IL-10 in different diseases and to develop new treatments. Its highly specific binding to IL-10 makes it a valuable tool for studying the function of this cytokine and its interactions with other immune cells.

Conclusion

In conclusion, Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade is a recombinant monoclonal antibody that has been designed to target the cytokine IL-10. Its fully humanized structure and ability to block IL-10 activity make it a promising therapeutic candidate for cancer and autoimmune diseases. Additionally, it can serve as a valuable research tool for studying the role of IL-10 in various diseases. Further studies and clinical trials are needed to fully understand the potential of Vimekofusp Biosimilar in the treatment of these conditions.

Vimekofusp Biosimilar - Anti-IL-10 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vimekofusp Biosimilar – Anti-IL-10 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products