Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL8 / CXCL8, C-His, recombinant protein

  • PX-P5796
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10145
Molecular weight:
9.89 kDa

$451.00

100ug + 451 loyalty points
Ala23–Ser99 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

IL8 / CXCL8, C-His, recombinant protein

Product name IL8 / CXCL8, C-His, recombinant protein
Uniprot ID P10145
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular weight 9.89 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala23-Ser99
Protein Accession P10145
Reference PX-P5796
Note For research use only.
Molecular Constructor
Ala23–Ser99 His

9-77 Biosimilar - Anti-IL-8 mAb binds to IL8/CXCL8 in indirect ELISA Assay

9-77 Biosimilar - Anti-IL-8 mAb binds to IL8/CXCL8 in indirect ELISA Assay

Immobilized IL8 / CXCL8, C-His, recombinant protein (cat. No.PX-P5796) at 0.5µg/mL (100µL/well) can bind to 9-77 Biosimilar - Anti-IL-8 mAb (cat. No.PX-TA1618) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD451

IL8 / CXCL8, C-His, recombinant protein

There are no reviews yet.

Be the first to review “IL8 / CXCL8, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products