Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A) |
|---|---|
| Uniprot ID | Q14213&P29459 |
| Uniprot link | https://www.uniprot.org/uniprot/P29459 |
| Expression system | Eukaryotic expression |
| Sequence | MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Molecular weight | 74.4kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >85% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Lys229(Q14213) & Arg23-Ser219(P29459) |
| Protein Accession | Q14213&P29459 |
| Spec:Entrez GeneID | 10148&3592 |
| Spec:NCBI Gene Aliases | IL27B; IL35B; IL-27B,P35; CLMF; NFSK; NKSF1; IL-12A |
| Spec:SwissProtID | Q14213&P29459 |
| NCBI Reference | Q14213&P29459 |
| Aliases /Synonyms | IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein,EBV-induced gene 3 protein,IL27B & IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cell stimulatory factor chain 1,NKSF1,NKSF1 |
| Reference | PX-P4678 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.