Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)

Host species:
Mammalian cells
Uniprot ID:
Q14213&P29459
Molecular weight:
74.4kDa

$250.00

50ug + 250 loyalty points
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)

Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)

Product name Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)
Uniprot ID Q14213&P29459
Uniprot link https://www.uniprot.org/uniprot/P29459
Expression system Eukaryotic expression
Sequence MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular weight 74.4kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys229(Q14213) & Arg23-Ser219(P29459)
Protein Accession Q14213&P29459
Spec:Entrez GeneID 10148&3592
Spec:NCBI Gene Aliases IL27B; IL35B; IL-27B,P35; CLMF; NFSK; NKSF1; IL-12A
Spec:SwissProtID Q14213&P29459
NCBI Reference Q14213&P29459
Aliases /Synonyms IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein,EBV-induced gene 3 protein,IL27B & IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cell stimulatory factor chain 1,NKSF1,NKSF1
Reference PX-P4678
Note For research use only
Molecular Constructor
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc
Product name Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)
Uniprot ID Q14213&P29459
Uniprot link https://www.uniprot.org/uniprot/P29459
Expression system Eukaryotic expression
Sequence MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular weight 74.4kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys229(Q14213) & Arg23-Ser219(P29459)
Protein Accession Q14213&P29459
Spec:Entrez GeneID 10148&3592
Spec:NCBI Gene Aliases IL27B; IL35B; IL-27B,P35; CLMF; NFSK; NKSF1; IL-12A
Spec:SwissProtID Q14213&P29459
NCBI Reference Q14213&P29459
Aliases /Synonyms IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein,EBV-induced gene 3 protein,IL27B & IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cell stimulatory factor chain 1,NKSF1,NKSF1
Reference PX-P4678
Note For research use only
Molecular Constructor
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc

There are no reviews yet.

Be the first to review “Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products