Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Interleukin-4 receptor subunit alpha(IL4R) |
|---|---|
| Uniprot ID | P24394 |
| Uniprot link | https://www.uniprot.org/uniprot/P24394 |
| Expression system | Eukaryotic expression |
| Sequence | MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGSHHHHHH |
| Molecular weight | 27.3kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-His232 |
| Protein Accession | P24394 |
| Spec:Entrez GeneID | 3566 |
| Spec:NCBI Gene Aliases | CD124; IL4RA; IL-4RA |
| Spec:SwissProtID | Q96P01 |
| NCBI Reference | P24394 |
| Aliases /Synonyms | IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124 |
| Reference | PX-P4860 |
| Note | For research use only |
Immobilized Interleukin-4 receptor subunit alpha(IL4R) (cat. No.PX-P4860) at 0.5µg/mL (100µL/well) can bind to Dupilumab Biosimilar - Anti-IL4R, CD124 mAb (cat. No.PX-TA1308) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Send us a message from the form below
Reviews
There are no reviews yet.