Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameIsoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot IDP36956-3
Uniprot linkhttps://www.uniprot.org/uniprot/P36956-3
Expression systemProkaryotic expression
SequenceMGSHHHHHHSGLEVLFQGPMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEA FLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGY PSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFI KADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKR TAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACG SGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDR SRLAL
Molecular weight50.2kDa
Protein delivered with Tag?N-terminal His Tag
Purity estimated>10% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMet1-Leu466
Protein AccessionP36956
Spec:Entrez GeneID6720
Spec:NCBI Gene AliasesHMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtIDQ16062
NCBI ReferenceP36956.2
Aliases /SynonymsSREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
ReferencePX-P4844
NoteFor research use only

Description of Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Introduction to Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Isoform SREBP-1C, also known as Sterol regulatory element-binding protein 1C, is a transcription factor that plays a crucial role in the regulation of lipid metabolism. It is one of the three isoforms of the SREBP family, which also includes SREBP-1a and SREBP-2. SREBP-1C is primarily expressed in the liver, adipose tissue, and skeletal muscle, and is involved in the regulation of genes involved in the biosynthesis of fatty acids and cholesterol. In this article, we will explore the structure, activity, and potential applications of Isoform SREBP-1C as a drug target.

Structure of Isoform SREBP-1C

Isoform SREBP-1C is a 114 kDa protein that consists of 1141 amino acids. It contains a DNA-binding domain, a transmembrane domain, and a C-terminal domain. The DNA-binding domain is responsible for binding to specific DNA sequences in the promoter regions of target genes, while the transmembrane domain anchors the protein to the endoplasmic reticulum membrane. The C-terminal domain contains a nuclear localization signal, which allows the protein to translocate to the nucleus and activate gene expression.

Activity of Isoform SREBP-1C

The activity of Isoform SREBP-1C is tightly regulated by a complex mechanism involving proteolytic cleavage and post-translational modifications. In its inactive form, SREBP-1C is bound to the endoplasmic reticulum membrane through its transmembrane domain. Upon activation, the N-terminal domain of SREBP-1C is released by proteolytic cleavage, allowing it to translocate to the nucleus and bind to specific DNA sequences. This leads to the activation of genes involved in the biosynthesis of fatty acids and cholesterol, such as FASN, ACC, and HMGCR.

Isoform SREBP-1C is also regulated by post-translational modifications, such as phosphorylation and acetylation. These modifications can affect the stability and activity of the protein, providing an additional layer of regulation. For example, phosphorylation of SREBP-1C by AMP-activated protein kinase (AMPK) can inhibit its activity, while acetylation by p300/CBP can enhance its transcriptional activity.

Potential Applications of Isoform SREBP-1C as a Drug Target

Given its crucial role in the regulation of lipid metabolism, Isoform SREBP-1C has emerged as a potential drug target for the treatment of metabolic disorders, such as obesity, type 2 diabetes, and dyslipidemia. Inhibition of SREBP-1C activity has been shown to reduce the expression of genes involved in fatty acid and cholesterol biosynthesis, leading to a decrease in lipid levels in the liver and blood.

Several studies have investigated the use of small molecule inhibitors and natural compounds to target Isoform SREBP-1C. For example, a compound called betulinic acid has been shown to inhibit SREBP-1C activity and reduce lipid levels in animal models of obesity and type 2 diabetes. Other compounds, such as statins and thiazolidinediones, have also been found to inhibit SREBP-1C activity and improve metabolic parameters in patients with dyslipidemia and type 2 diabetes.

In addition to its potential as a drug target, Isoform SREBP-1C has also been studied as a biomarker for various metabolic disorders. Elevated levels of SREBP-1C have been observed in patients with obesity, type 2 diabetes, and non-alcoholic fatty liver disease (NAFLD), making it a potential diagnostic and prognostic marker for these conditions.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Isoform SREBP-1C of Sterol regulatory element-binding protein 1”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products