Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Isoform SREBP-1C of Sterol regulatory element-binding protein 1 |
|---|---|
| Uniprot ID | P36956-3 |
| Uniprot link | https://www.uniprot.org/uniprot/P36956-3 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGLEVLFQGPMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEA FLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGY PSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFI KADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKR TAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACG SGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDR SRLAL |
| Molecular weight | 50.2kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >10% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Leu466 |
| Protein Accession | P36956 |
| Spec:Entrez GeneID | 6720 |
| Spec:NCBI Gene Aliases | HMD; IFAP2; SREBP1; bHLHd1 |
| Spec:SwissProtID | Q16062 |
| NCBI Reference | P36956.2 |
| Aliases /Synonyms | SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1 |
| Reference | PX-P4844 |
| Note | For research use only |
Isoform SREBP-1C, also known as Sterol regulatory element-binding protein 1C, is a transcription factor that plays a crucial role in the regulation of lipid metabolism. It is one of the three isoforms of the SREBP family, which also includes SREBP-1a and SREBP-2. SREBP-1C is primarily expressed in the liver, adipose tissue, and skeletal muscle, and is involved in the regulation of genes involved in the biosynthesis of fatty acids and cholesterol. In this article, we will explore the structure, activity, and potential applications of Isoform SREBP-1C as a drug target.
Isoform SREBP-1C is a 114 kDa protein that consists of 1141 amino acids. It contains a DNA-binding domain, a transmembrane domain, and a C-terminal domain. The DNA-binding domain is responsible for binding to specific DNA sequences in the promoter regions of target genes, while the transmembrane domain anchors the protein to the endoplasmic reticulum membrane. The C-terminal domain contains a nuclear localization signal, which allows the protein to translocate to the nucleus and activate gene expression.
The activity of Isoform SREBP-1C is tightly regulated by a complex mechanism involving proteolytic cleavage and post-translational modifications. In its inactive form, SREBP-1C is bound to the endoplasmic reticulum membrane through its transmembrane domain. Upon activation, the N-terminal domain of SREBP-1C is released by proteolytic cleavage, allowing it to translocate to the nucleus and bind to specific DNA sequences. This leads to the activation of genes involved in the biosynthesis of fatty acids and cholesterol, such as FASN, ACC, and HMGCR.
Isoform SREBP-1C is also regulated by post-translational modifications, such as phosphorylation and acetylation. These modifications can affect the stability and activity of the protein, providing an additional layer of regulation. For example, phosphorylation of SREBP-1C by AMP-activated protein kinase (AMPK) can inhibit its activity, while acetylation by p300/CBP can enhance its transcriptional activity.
Given its crucial role in the regulation of lipid metabolism, Isoform SREBP-1C has emerged as a potential drug target for the treatment of metabolic disorders, such as obesity, type 2 diabetes, and dyslipidemia. Inhibition of SREBP-1C activity has been shown to reduce the expression of genes involved in fatty acid and cholesterol biosynthesis, leading to a decrease in lipid levels in the liver and blood.
Several studies have investigated the use of small molecule inhibitors and natural compounds to target Isoform SREBP-1C. For example, a compound called betulinic acid has been shown to inhibit SREBP-1C activity and reduce lipid levels in animal models of obesity and type 2 diabetes. Other compounds, such as statins and thiazolidinediones, have also been found to inhibit SREBP-1C activity and improve metabolic parameters in patients with dyslipidemia and type 2 diabetes.
In addition to its potential as a drug target, Isoform SREBP-1C has also been studied as a biomarker for various metabolic disorders. Elevated levels of SREBP-1C have been observed in patients with obesity, type 2 diabetes, and non-alcoholic fatty liver disease (NAFLD), making it a potential diagnostic and prognostic marker for these conditions.
Send us a message from the form below
Reviews
There are no reviews yet.