Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P36956-3
Molecular weight:
50.2kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
His Met1–Leu466
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Product name Isoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only
Molecular Constructor
His Met1–Leu466
Product name Isoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only
Molecular Constructor
His Met1–Leu466
Product name PX-P4844-1MG
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only.
Molecular Constructor
His Met1–Leu466

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

There are no reviews yet.

Be the first to review “Isoform SREBP-1C of Sterol regulatory element-binding protein 1”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products