Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | KAT8 regulatory NSL complex subunit 1(Kansl1) |
---|---|
Uniprot ID | Q80TG1 |
Uniprot link | https://www.uniprot.org/uniprot/Q80TG1 |
Expression system | Prokaryotic expression |
Sequence | MKEILTPSWREVDVQSLKGSPDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEFSHGQSPRSPISPELHSAPLTPVARDSLRHLASEDTRCSTPELGLDEQSVQPWERRTFPLAYSPQAECEEQLDAQDTAARCTRRTSGSKTGREAEVAPTSPPVVPLKSRHLAATVTAQRPAHRGSHHHHHH |
Molecular weight | 25.60kDa |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Lys814-Arg1036 |
Aliases /Synonyms | NSL complex protein NSL1,Non-specific lethal 1 homolog,Kiaa1267, Nsl1 |
Reference | PX-P4737 |
Note | For research use only |
As part of the NSL complex, it is involved in the acetylation of nucleosomal histone H4 in various lysed residues, so it may be involved in the regulation of transcription.nKANSL1 (subunit 1 of the NSL regulatory complex of KAT8) is a gene encoding the protein. Diseases associated with KANSL1 include Cullen-De Vries syndrome and Cullen-De Vries syndrome, caused by mutations in the puncture. Related pathways include the organization of chromatin and the pathway of adenoid cystic carcinoma. The genetic ontology (GO) annotations related to this gene include the activity of histone acetyltransferase (specificity of H4-K5) and the activity of histone acetyltransferase (specificity of H4-K16). The important counterpart of this gene is KANSL1L.
Send us a message from the form below
Reviews
There are no reviews yet.