Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Kelch-like ECH-associated protein 1(KEAP1) |
|---|---|
| Uniprot ID | Q14145 |
| Uniprot link | https://www.uniprot.org/uniprot/Q14145 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACI |
| Molecular weight | 18.07 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ala90-IIe250 |
| Protein Accession | Q14145 |
| Spec:Entrez GeneID | 9817 |
| Spec:NCBI Gene Aliases | INrf2; KLHL19 |
| Spec:SwissProtID | Q9BPY9 |
| NCBI Reference | Q14145 |
| Aliases /Synonyms | Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19 |
| Reference | PX-P4789 |
| Note | For research use only. |
Send us a message from the form below
Reviews
There are no reviews yet.