Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Leishmania CPACter Recombinant Protein |
---|---|
Uniprot ID | Q9BIE1 |
Uniprot link | http://www.uniprot.org/uniprot/Q9BIE1 |
Origin species | Leishmania |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTGNIEGQWALKNHSL VSLSEQVLVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYPYTSAGGTRPPCHDNGTVGAKIAGYMSLPHDEEEIA AYVGKNGPVAVAVDATTWQLYFGGVVTLCFGLSLNHGVLVVGFNRQAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLK NYAVTATIDDSNTSHVPTTAA |
Molecular weight | 27,85 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, imidazole 300mM |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | AAK27384.1 |
Spec:Entrez GeneID | 13386130 |
Spec:SwissProtID | Q9BIE1 |
NCBI Reference | AAK27384.1 |
Aliases /Synonyms | CPACter (E. coli optimized), Cysteine Peptidase A C-terminal region,Cysteine proteinase-like protein |
Reference | PX-P1064 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.