Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leishmania CPACter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Leishmania
Uniprot ID:
Q9BIE1
Molecular weight:
27,85 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Leishmania CPACter Recombinant Protein

Product name Leishmania CPACter Recombinant Protein
Uniprot ID Q9BIE1
Uniprot link http://www.uniprot.org/uniprot/Q9BIE1
Origin species Leishmania
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTGNIEGQWALKNHSL VSLSEQVLVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYPYTSAGGTRPPCHDNGTVGAKIAGYMSLPHDEEEIA AYVGKNGPVAVAVDATTWQLYFGGVVTLCFGLSLNHGVLVVGFNRQAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLK NYAVTATIDDSNTSHVPTTAA
Molecular weight 27,85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAK27384.1
Spec:Entrez GeneID 13386130
Spec:SwissProtID Q9BIE1
NCBI Reference AAK27384.1
Aliases /Synonyms CPACter (E. coli optimized), Cysteine Peptidase A C-terminal region,Cysteine proteinase-like protein
Reference PX-P1064
Note For research use only
Molecular Constructor
Partial Yes
Product name Leishmania CPACter Recombinant Protein
Uniprot ID Q9BIE1
Uniprot link http://www.uniprot.org/uniprot/Q9BIE1
Origin species Leishmania
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTGNIEGQWALKNHSL VSLSEQVLVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYPYTSAGGTRPPCHDNGTVGAKIAGYMSLPHDEEEIA AYVGKNGPVAVAVDATTWQLYFGGVVTLCFGLSLNHGVLVVGFNRQAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLK NYAVTATIDDSNTSHVPTTAA
Molecular weight 27,85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAK27384.1
Spec:Entrez GeneID 13386130
Spec:SwissProtID Q9BIE1
NCBI Reference AAK27384.1
Aliases /Synonyms CPACter (E. coli optimized), Cysteine Peptidase A C-terminal region,Cysteine proteinase-like protein
Reference PX-P1064
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Leishmania CPACter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products