Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mannose-binding protein C(Mbl2)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Mannose-binding protein C(Mbl2) |
|---|---|
| Uniprot ID | P41317 |
| Uniprot link | https://www.uniprot.org/uniprot/P41317 |
| Expression system | Eukaryotic expression |
| Sequence | MKMIILVVSLHVLRNSAAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSDGSHHHHHH |
| Molecular weight | 26.86kDa |
| Protein delivered with Tag? | C-terminal His-tag |
| Purity estimated | 90% by SDS-PAGE |
| Buffer | PBS, pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Fragment Type | full length |
| Protein Accession | P41317 |
| Spec:Entrez GeneID | 17195 |
| Spec:NCBI Gene Aliases | MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A |
| NCBI Reference | P41317 |
| Aliases /Synonyms | MBP-C, RARF/P28A |
| Reference | PX-P4531 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.