Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mannose-binding protein C(Mbl2)

Host species:
Insect
Uniprot ID:
P41317
Molecular weight:
26.86kDa

Original price was: $309.00.Current price is: $250.00.

50ug 19% OFF + 250 loyalty points
full length His-tag
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mannose-binding protein C(Mbl2)

Product name Mannose-binding protein C(Mbl2)
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag
Product name Mannose-binding protein C(Mbl2)
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag
Product name PX-P4531-1MG
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag

Mannose-binding protein C(Mbl2)

There are no reviews yet.

Be the first to review “Mannose-binding protein C(Mbl2)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products