Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein |
---|---|
Uniprot ID | P16455 |
Uniprot link | http://www.uniprot.org/uniprot/P16455 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK |
Molecular weight | 38.40 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 10% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Unknown |
Protein Accession | AFU51890.1 |
Spec:Entrez GeneID | 4255 |
Spec:SwissProtID | P16455 |
NCBI Reference | AFU51890.1 |
Aliases /Synonyms | PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase |
Reference | PX-P2087 |
Note | For research use only |
MGMT Protein, also known as O6-methylguanine-DNA methyltransferase, is a key enzyme involved in DNA repair. It plays a crucial role in protecting cells from DNA damage caused by alkylating agents, which are commonly used in chemotherapy treatments. However, the overexpression of MGMT Protein in cancer cells can lead to drug resistance, making it an attractive drug target for cancer therapy.
MGMT Protein is a 207 amino acid long protein with a molecular weight of approximately 23 kDa. It consists of two domains: the N-terminal DNA binding domain and the C-terminal catalytic domain. The N-terminal domain is responsible for recognizing and binding to damaged DNA, while the C-terminal domain is responsible for the enzymatic activity of MGMT Protein.
The primary function of MGMT Protein is to remove alkyl groups from the O6 position of guanine in DNA. This process, known as O6-alkylguanine DNA alkyltransferase, restores the integrity of the DNA and prevents mutations and cell death. MGMT Protein is able to repair a wide range of DNA lesions, making it a vital component of the DNA repair machinery.
The PelB-DN10-ST (virer PelB) Recombinant Protein is a modified form of MGMT Protein that has been optimized for therapeutic use. It is produced using recombinant DNA technology and has been shown to have improved stability and activity compared to the native MGMT Protein.
One of the main applications of PelB-DN10-ST (virer PelB) Recombinant Protein is in cancer therapy. The overexpression of MGMT Protein in cancer cells is a major cause of resistance to alkylating agents, which are commonly used in chemotherapy. By using PelB-DN10-ST (virer PelB) Recombinant Protein, the activity of MGMT Protein can be selectively inhibited in cancer cells, making them more susceptible to the effects of chemotherapy. This approach has been shown to improve the efficacy of chemotherapy and overcome drug resistance in various types of cancer, including glioblastoma, colorectal cancer, and lung cancer.
In addition to its use in cancer therapy, PelB-DN10-ST (virer PelB) Recombinant Protein has also shown potential in the treatment of other diseases. Studies have shown that it can be used to enhance the effectiveness of radiotherapy, as well as protect against DNA damage caused by environmental toxins and oxidative stress. It has also been explored as a potential therapy for neurodegenerative disorders, such as Parkinson’s and Alzheimer’s disease, as well as autoimmune disorders, such as multiple sclerosis.
In conclusion, MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein is a promising drug target with a wide range of applications in cancer therapy and other diseases. Its unique ability to repair DNA damage and its potential to overcome drug resistance make it a valuable tool in the fight against cancer. With ongoing research and development, PelB-DN10-ST (virer PelB) Recombinant Protein has the potential to improve the effectiveness of current treatments and pave the way for new therapeutic strategies.
Send us a message from the form below
Reviews
There are no reviews yet.