Name: Mucin-4(MUC4) Nter GST
SKU: PX-P4406-10
Availability: InStock

Product name	Mucin-4(MUC4) Nter GST
Uniprot ID	Q99102
Uniprot link	https://www.uniprot.org/uniprot/Q99102
Expression system	Prokaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight	30.75kDa
Protein delivered with Tag?	N-terminal Gst Tag
Purity estimated	90% by SDS-PAGE
Buffer	50 mM Tris-HCl ，pH 8.0, 150 mM NaCl
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Gln1875-Phe1914
Protein Accession	Q99102
Spec:Entrez GeneID	4585
Spec:NCBI Gene Aliases	ASGP; MUC-4; HSA276359
Spec:SwissProtID	Q9GZM2
NCBI Reference	Q99102
Aliases /Synonyms	MUC4/Mucin-4
Reference	PX-P4406
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mucin-4(MUC4) Nter GST”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17859 214$

View product