Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Mucin-4(MUC4) Nter GST |
|---|---|
| Uniprot ID | Q99102 |
| Uniprot link | https://www.uniprot.org/uniprot/Q99102 |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF |
| Molecular weight | 30.75kDa |
| Protein delivered with Tag? | N-terminal Gst Tag |
| Purity estimated | 90% by SDS-PAGE |
| Buffer | 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln1875-Phe1914 |
| Protein Accession | Q99102 |
| Spec:Entrez GeneID | 4585 |
| Spec:NCBI Gene Aliases | ASGP; MUC-4; HSA276359 |
| Spec:SwissProtID | Q9GZM2 |
| NCBI Reference | Q99102 |
| Aliases /Synonyms | MUC4/Mucin-4 |
| Reference | PX-P4406 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.