Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mucin-4(MUC4) Nter GST

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q99102
Molecular weight:
30.75kDa

$392.00

100ug + 392 loyalty points
Gst Gln1875–Phe1914
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mucin-4(MUC4) Nter GST

Product name Mucin-4(MUC4) Nter GST
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight 30.75kDa
Protein delivered with Tag? N-terminal Gst Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Phe1914
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4
Reference PX-P4406
Note For research use only
Molecular Constructor
Gst Gln1875–Phe1914
Product name Mucin-4(MUC4) Nter GST
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF
Molecular weight 30.75kDa
Protein delivered with Tag? N-terminal Gst Tag
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl ,pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Phe1914
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4
Reference PX-P4406
Note For research use only
Molecular Constructor
Gst Gln1875–Phe1914

There are no reviews yet.

Be the first to review “Mucin-4(MUC4) Nter GST”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products