Name: Mucin-4(MUC4) EGF Like 1 and 2
SKU: PX-P4396-10
Availability: InStock

Product name	Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID	Q99102
Uniprot link	https://www.uniprot.org/uniprot/Q99102
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight	30.26KDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	70% by SDS-PAGE
Buffer	50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Gln1875-Glu2117
Protein Accession	Q99102
Spec:Entrez GeneID	4585
Spec:NCBI Gene Aliases	ASGP; MUC-4; HSA276359
Spec:SwissProtID	Q9GZM2
NCBI Reference	Q99102
Aliases /Synonyms	MUC4/Mucin-4, ASGP-1
Reference	PX-P4396
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mucin-4(MUC4) EGF Like 1 and 2”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 189$

View product