Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mucin-4(MUC4) EGF Like 1 and 2

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q99102
Molecular weight:
30.26KDa

$469.00

100ug + 469 loyalty points
Gln1875–Glu2117 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mucin-4(MUC4) EGF Like 1 and 2

Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His
Product name Mucin-4(MUC4) EGF Like 1 and 2
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMAQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISEEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEGSHHHHHH
Molecular weight 30.26KDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated 70% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM GSH, 0.5 mM GSSG
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln1875-Glu2117
Protein Accession Q99102
Spec:Entrez GeneID 4585
Spec:NCBI Gene Aliases ASGP; MUC-4; HSA276359
Spec:SwissProtID Q9GZM2
NCBI Reference Q99102
Aliases /Synonyms MUC4/Mucin-4, ASGP-1
Reference PX-P4396
Note For research use only
Molecular Constructor
Gln1875–Glu2117 His

There are no reviews yet.

Be the first to review “Mucin-4(MUC4) EGF Like 1 and 2”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products