Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mucin-4(MUC4)(1869-1925)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Mucin-4(MUC4)(1869-1925) |
|---|---|
| Uniprot ID | Q99102 |
| Uniprot link | https://www.uniprot.org/uniprot/Q99102 |
| Origin species | Human |
| Expression system | Eukaryotic expression |
| Sequence | MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH* |
| Molecular weight | 9.55kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | / |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Fragment Type | Gly1869-Asn1925 |
| Aliases /Synonyms | Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin |
| Reference | PX-P4275 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.