Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mucin-4(MUC4)(1869-1925)

Host species:
Insect
Origin species:
Human
Uniprot ID:
Q99102
Molecular weight:
9.55kDa

$500.00

+ 500 loyalty points
Gly1869–Asn1925 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mucin-4(MUC4)(1869-1925)

Mucin-4(MUC4)(1869-1925)

Product name Mucin-4(MUC4)(1869-1925)
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Origin species Human
Expression system Eukaryotic expression
Sequence MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH*
Molecular weight 9.55kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated /
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Gly1869-Asn1925
Aliases /Synonyms Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin
Reference PX-P4275
Note For research use only
Molecular Constructor
Gly1869–Asn1925 His
Product name Mucin-4(MUC4)(1869-1925)
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Origin species Human
Expression system Eukaryotic expression
Sequence MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH*
Molecular weight 9.55kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated /
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Gly1869-Asn1925
Aliases /Synonyms Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin
Reference PX-P4275
Note For research use only
Molecular Constructor
Gly1869–Asn1925 His

There are no reviews yet.

Be the first to review “Mucin-4(MUC4)(1869-1925)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products