Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human ACVR1B recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P36896
Molecular weight:
14.55 kDa

Original price was: $406.00.Current price is: $327.00.

100ug 19% OFF + 327 loyalty points
Met1–Glu126 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human ACVR1B recombinant protein
Human ACVR1B recombinant protein

Human ACVR1B recombinant protein

Product name PX-P6365-100
Uniprot ID P36896
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Molecular weight 14.55 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu126
Aliases /Synonyms 2.7.11.30, Activin receptor type IB, ACTR-IB, Activin receptor-like kinase 4, ALK-4, Serine/threonine-protein kinase receptor R2, SKR2, ACVR1B, ACVRLK4, ALK4Activin receptor type-1B,
Reference PX-P6365
Molecular Constructor
Met1–Glu126 His
Product name PX-P6365-1MG
Uniprot ID P36896
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Molecular weight 14.55 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu126
Aliases /Synonyms 2.7.11.30, Activin receptor type IB, ACTR-IB, Activin receptor-like kinase 4, ALK-4, Serine/threonine-protein kinase receptor R2, SKR2, ACVR1B, ACVRLK4, ALK4Activin receptor type-1B,
Reference PX-P6365
Molecular Constructor
Met1–Glu126 His
Product name PX-P6365-50
Uniprot ID P36896
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Molecular weight 14.55 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu126
Aliases /Synonyms 2.7.11.30, Activin receptor type IB, ACTR-IB, Activin receptor-like kinase 4, ALK-4, Serine/threonine-protein kinase receptor R2, SKR2, ACVR1B, ACVRLK4, ALK4Activin receptor type-1B,
Reference PX-P6365
Molecular Constructor
Met1–Glu126 His

SDS-PAGE for Human ACVR1B recombinant protein

SDS-PAGE for Human ACVR1B recombinant protein

Human ACVR1B recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human ACVR1B recombinant protein

There are no reviews yet.

Be the first to review “Human ACVR1B recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products