Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mucin-5B(MUC5B)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Mucin-5B(MUC5B) |
|---|---|
| Uniprot ID | Q9HC84 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9HC84 |
| Expression system | Prokaryotic expression |
| Sequence | MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDENLYFQGSCQVRINTTILWHQGCETEVNITFAEGSCPGASKYSAEAQAMQHQCTCAQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPA |
| Molecular weight | 37.43kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.4, 1mM EDTA, 4%trehalose, 1% mannitol |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser5657-Ala5756 |
| Aliases /Synonyms | MUC-5B,Cervical mucin,High molecular weight salivary mucin MG1,Mucin-5 subtype B, tracheobronchial,Sublingual gland mucin,MUC5 |
| Reference | PX-P4752 |
| Note | For research use only. |
Related products
Biosimilar
Homo sapiens Biosimilar – Anti-MUC5AC mAb – Research Grade
PX-TA1244 238$
Biosimilar
Sofituzumab Biosimilar – Anti-MUC16, CA125 mAb – Research Grade
PX-TA1338 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.