Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
N-acyl homoserine lactone hydrolase (SAMN04487767_102296)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | N-acyl homoserine lactone hydrolase (SAMN04487767_102296) |
|---|---|
| Uniprot ID | A0A1D3P3H1 |
| Uniprot link | https://www.uniprot.org/uniprot/A0A1D3P3H1 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI |
| Molecular weight | 29.20KDa |
| Purity estimated | 90% |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Met1-Ile250 |
| Aliases /Synonyms | N-acyl homoserine lactonase/N-acyl homoserine lactone hydrolase |
| Reference | PX-P4359 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.