Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

N-acyl homoserine lactone hydrolase (SAMN04487767_102296)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A1D3P3H1
Molecular weight:
29.20KDa

$392.00

100ug + 392 loyalty points
Met1–Ile250
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

N-acyl homoserine lactone hydrolase (SAMN04487767_102296)

Product name N-acyl homoserine lactone hydrolase (SAMN04487767_102296)
Uniprot ID A0A1D3P3H1
Uniprot link https://www.uniprot.org/uniprot/A0A1D3P3H1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.20KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ile250
Aliases /Synonyms N-acyl homoserine lactonase/N-acyl homoserine lactone hydrolase
Reference PX-P4359
Note For research use only
Molecular Constructor
Met1–Ile250
Product name N-acyl homoserine lactone hydrolase (SAMN04487767_102296)
Uniprot ID A0A1D3P3H1
Uniprot link https://www.uniprot.org/uniprot/A0A1D3P3H1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.20KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ile250
Aliases /Synonyms N-acyl homoserine lactonase/N-acyl homoserine lactone hydrolase
Reference PX-P4359
Note For research use only
Molecular Constructor
Met1–Ile250

There are no reviews yet.

Be the first to review “N-acyl homoserine lactone hydrolase (SAMN04487767_102296)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products