Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Caenorhabditis F52B5 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Caenorhabditis
Uniprot ID:
Q20643
Molecular weight:
35.69 kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Caenorhabditis F52B5 Recombinant Protein

Product name Caenorhabditis F52B5 Recombinant Protein
Uniprot ID Q20643
Uniprot link http://www.uniprot.org/uniprot/Q20643
Origin species Caenorhabditis
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMDNEKKSMYEPGVILGGCTLRRQLNDSGEAMVFLAESGNEEKKEVIIKFFKCGYGEDEIKYLDVLTNHEQRRNIVEMLKSFETPEIRLGMVFKRYETDLFGILGDRQRLQPSTIQKYMKGLMEGLQFIHRMDYIHRDIKPENLLIDGETICIADFGETVLSTSDKVVKPGTLPYLTIEHILGYKENTKSMDIWAAACVLGAMFQGSHLFSQNSNLQTIHAIRLLLGNHTKETWPEMDKLPLMQS
Molecular weight 35.69 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_492259.1
Spec:Entrez GeneID 172614
Spec:SwissProtID Q20643
NCBI Reference NP_492259.1
Aliases /Synonyms F52B5, F52B5.2
Reference PX-P2070
Note For research use only
Molecular Constructor
Partial Yes
Product name Caenorhabditis F52B5 Recombinant Protein
Uniprot ID Q20643
Uniprot link http://www.uniprot.org/uniprot/Q20643
Origin species Caenorhabditis
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMDNEKKSMYEPGVILGGCTLRRQLNDSGEAMVFLAESGNEEKKEVIIKFFKCGYGEDEIKYLDVLTNHEQRRNIVEMLKSFETPEIRLGMVFKRYETDLFGILGDRQRLQPSTIQKYMKGLMEGLQFIHRMDYIHRDIKPENLLIDGETICIADFGETVLSTSDKVVKPGTLPYLTIEHILGYKENTKSMDIWAAACVLGAMFQGSHLFSQNSNLQTIHAIRLLLGNHTKETWPEMDKLPLMQS
Molecular weight 35.69 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_492259.1
Spec:Entrez GeneID 172614
Spec:SwissProtID Q20643
NCBI Reference NP_492259.1
Aliases /Synonyms F52B5, F52B5.2
Reference PX-P2070
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P2070-1MG
Uniprot ID Q20643
Uniprot link http://www.uniprot.org/uniprot/Q20643
Origin species Caenorhabditis
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMDNEKKSMYEPGVILGGCTLRRQLNDSGEAMVFLAESGNEEKKEVIIKFFKCGYGEDEIKYLDVLTNHEQRRNIVEMLKSFETPEIRLGMVFKRYETDLFGILGDRQRLQPSTIQKYMKGLMEGLQFIHRMDYIHRDIKPENLLIDGETICIADFGETVLSTSDKVVKPGTLPYLTIEHILGYKENTKSMDIWAAACVLGAMFQGSHLFSQNSNLQTIHAIRLLLGNHTKETWPEMDKLPLMQS
Molecular weight 35.69 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_492259.1
Spec:Entrez GeneID 172614
Spec:SwissProtID Q20643
NCBI Reference NP_492259.1
Aliases /Synonyms F52B5, F52B5.2
Reference PX-P2070
Note For research use only
Molecular Constructor
Partial Yes

Caenorhabditis  F52B5 Recombinant Protein

There are no reviews yet.

Be the first to review “Caenorhabditis F52B5 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products