Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Phosphatidylethanolamine-binding protein 1(PEBP1) |
|---|---|
| Uniprot ID | P30086 |
| Uniprot link | https://www.uniprot.org/uniprot/P30086 |
| Expression system | Eukaryotic expression |
| Sequence | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKGSHHHHHH |
| Molecular weight | 21.98kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Lys187 |
| Protein Accession | P30086 |
| Spec:Entrez GeneID | 5037 |
| Spec:NCBI Gene Aliases | PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96 |
| Spec:SwissProtID | B2R4S1 |
| NCBI Reference | P30086 |
| Aliases /Synonyms | PEBP-1, HCNPpp, RKIP, HCNP, PBP, PEBP |
| Reference | PX-P4869 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.