Name: Phosphatidylethanolamine-binding protein 1(PEBP1)
SKU: PX-P4869-10
Availability: InStock

Product name	Phosphatidylethanolamine-binding protein 1(PEBP1)
Uniprot ID	P30086
Uniprot link	https://www.uniprot.org/uniprot/P30086
Expression system	Eukaryotic expression
Sequence	MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKGSHHHHHH
Molecular weight	21.98kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1-Lys187
Protein Accession	P30086
Spec:Entrez GeneID	5037
Spec:NCBI Gene Aliases	PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96
Spec:SwissProtID	B2R4S1
NCBI Reference	P30086
Aliases /Synonyms	PEBP-1, HCNPpp, RKIP, HCNP, PBP, PEBP
Reference	PX-P4869
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Phosphatidylethanolamine-binding protein 1(PEBP1)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 189$

View product