Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Phosphatidylethanolamine-binding protein 1(PEBP1)

Host species:
Mammalian cells
Uniprot ID:
P30086
Molecular weight:
21.98kDa

$500.00

100ug + 500 loyalty points
Met1–Lys187 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Phosphatidylethanolamine-binding protein 1(PEBP1)

Product name Phosphatidylethanolamine-binding protein 1(PEBP1)
Uniprot ID P30086
Uniprot link https://www.uniprot.org/uniprot/P30086
Expression system Eukaryotic expression
Raw Antigen Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKGSHHHHHH
Molecular weight 21.98kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys187
Protein Accession P30086
Spec:Entrez GeneID 5037
Spec:NCBI Gene Aliases PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96
Spec:SwissProtID B2R4S1
NCBI Reference P30086
Aliases /Synonyms PEBP-1, HCNPpp, RKIP, HCNP, PBP, PEBP
Reference PX-P4869
Note For research use only
Molecular Constructor
Met1–Lys187 His
Product name Phosphatidylethanolamine-binding protein 1(PEBP1)
Uniprot ID P30086
Uniprot link https://www.uniprot.org/uniprot/P30086
Expression system Eukaryotic expression
Raw Antigen Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKGSHHHHHH
Molecular weight 21.98kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys187
Protein Accession P30086
Spec:Entrez GeneID 5037
Spec:NCBI Gene Aliases PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96
Spec:SwissProtID B2R4S1
NCBI Reference P30086
Aliases /Synonyms PEBP-1, HCNPpp, RKIP, HCNP, PBP, PEBP
Reference PX-P4869
Note For research use only
Molecular Constructor
Met1–Lys187 His

There are no reviews yet.

Be the first to review “Phosphatidylethanolamine-binding protein 1(PEBP1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products