Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fibrinogen-like protein 1(FGL1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q08830
Molecular weight:
35.32kDa

$250.00

50ug + 250 loyalty points
Met1–IIe312 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fibrinogen-like protein 1(FGL1)

Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His
Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His
Product name Fibrinogen-like protein 1(FGL1)
Uniprot ID Q08830
Uniprot link https://www.uniprot.org/uniprot/Q08830
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVIGSHHHHHH
Molecular weight 35.32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-IIe312
Protein Accession Q08830
Spec:Entrez GeneID 2267
Spec:NCBI Gene Aliases HPS; HFREP1; HP-041; LFIRE1; LFIRE-1
Spec:SwissProtID Q4PJH9
NCBI Reference Q08830
Aliases /Synonyms HP-041,Hepassocin,HPS,Hepatocyte-derived fibrinogen-related protein 1,HFREP-1,Liver fibrinogen-related protein 1,LFIRE-1,HFREP1
Reference PX-P4638
Note For research use only
Molecular Constructor
Met1–IIe312 His

There are no reviews yet.

Be the first to review “Fibrinogen-like protein 1(FGL1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products