Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1) |
|---|---|
| Uniprot ID | P27986 |
| Uniprot link | https://www.uniprot.org/uniprot/P27986 |
| Expression system | Prokaryotic expression |
| Sequence | MWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVLEHHHHHH |
| Molecular weight | 11.8kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >80% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Trp624-Val718 |
| Protein Accession | P27986 |
| Spec:Entrez GeneID | 5295 |
| Spec:NCBI Gene Aliases | p85; AGM7; GRB1; IMD36; p85-ALPHA |
| Spec:SwissProtID | Q15747 |
| NCBI Reference | P27986 |
| Aliases /Synonyms | PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1 |
| Reference | PX-P4850 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.