Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P27986
Molecular weight:
11.8kDa

Original price was: $320.00.Current price is: $250.00.

50ug 22% OFF + 250 loyalty points
Trp624–Val718 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)

Product name Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
Uniprot ID P27986
Uniprot link https://www.uniprot.org/uniprot/P27986
Expression system Prokaryotic expression
Raw Antigen Sequence WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Molecular weight 11.8kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp624-Val718
Protein Accession P27986
Spec:Entrez GeneID 5295
Spec:NCBI Gene Aliases p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID Q15747
NCBI Reference P27986
Aliases /Synonyms PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference PX-P4850
Note For research use only
Molecular Constructor
Trp624–Val718 His
Product name Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
Uniprot ID P27986
Uniprot link https://www.uniprot.org/uniprot/P27986
Expression system Prokaryotic expression
Raw Antigen Sequence WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Molecular weight 11.8kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp624-Val718
Protein Accession P27986
Spec:Entrez GeneID 5295
Spec:NCBI Gene Aliases p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID Q15747
NCBI Reference P27986
Aliases /Synonyms PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference PX-P4850
Note For research use only
Molecular Constructor
Trp624–Val718 His
Product name PX-P4850-1MG
Uniprot ID P27986
Uniprot link https://www.uniprot.org/uniprot/P27986
Expression system Prokaryotic expression
Raw Antigen Sequence WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Molecular weight 11.8kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp624-Val718
Protein Accession P27986
Spec:Entrez GeneID 5295
Spec:NCBI Gene Aliases p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID Q15747
NCBI Reference P27986
Aliases /Synonyms PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference PX-P4850
Note For research use only
Molecular Constructor
Trp624–Val718 His

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)

There are no reviews yet.

Be the first to review “Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products