Brand: ProteoGenix

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

PTX19906-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit
Isotype:: IgG

Original price was: $182.00.Current price is: $140.00.

50ug 23% OFF + 140 loyalty points

Size Size

50ug Original price was: $182.00.Current price is: $140.00.
100ug Original price was: $259.00.Current price is: $201.00.
1MG Original price was: $798.00.Current price is: $583.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

Product name	PTX19906-100
Uniprot ID	P27986
Raw Antigen Sequence	WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-PIK3R1, Anti-PI3-kinase p85-alpha
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Product name	PTX19906-1MG
Uniprot ID	P27986
Raw Antigen Sequence	WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-PIK3R1, Anti-PI3-kinase p85-alpha
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Product name	PTX19906-50
Uniprot ID	P27986
Raw Antigen Sequence	WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-PIK3R1, Anti-PI3-kinase p85-alpha
Isotype	IgG
Clonality	Polyclonal Antibody
Protein Name	Human,Mouse,Rat

Datasheet

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody binds to Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1) in WB Assay

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)(cat. No.PX-P4850) can bind Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody binds to Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1) in WB Assay

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

Specifications Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody

Documents

QC & Validation

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody binds to Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1) in WB Assay

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-PIK3R1/PI3-kinase p85-alpha Polyclonal Antibody