Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Placenta-specific protein 1(PLAC1) |
|---|---|
| Uniprot ID | Q9HBJ0 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9HBJ0 |
| Expression system | Prokaryotic expression |
| Sequence | MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGIEENLYFQGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSMHHHHHH |
| Molecular weight | 48.75kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5, 4M urea |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln23-Met212 |
| Reference | PX-P4344 |
| Note | For research use only |
Placenta-specific protein 1 is a small secreted cell surface protein (212 amino acids) encoded by the PLAC1 gene on the X chromosome. Since its discovery in 1999, PLAC1 has played a role in the development and maintenance of the placenta, including preeclampsia, fetal development, and many cancers.
Send us a message from the form below
Reviews
There are no reviews yet.