Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Putative trypsinogen(try)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Yeast |
| Applications | Elisa, WB |
| Product name | Putative trypsinogen(try) |
|---|---|
| Uniprot ID | C6L245 |
| Uniprot link | https://www.uniprot.org/uniprot/C6L245 |
| Expression system | Eukaryotic expression |
| Sequence | DEDDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGENNIDVLEGDEQFIDAAKIIRHPKYNSWTLDNDILLIKLSSPAVLNSRVSTLALPSACAPAGTLCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGEITSNMVCAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKNRPGVYTKVCNYVDWIQQTIAANSHHHHHH |
| Molecular weight | 25.3kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH 6.0 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Yeast |
| Fragment Type | Asp20-Ser247 |
| Protein Accession | BAH86994 |
| Spec:Entrez GeneID | 100525899 |
| Spec:NCBI Gene Aliases | TRY |
| NCBI Reference | BAH86994 |
| Aliases /Synonyms | PRSS2 |
| Reference | PX-P4830 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.