Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Putative trypsinogen(try)

Host species:
Yeast
Uniprot ID:
C6L245
Molecular weight:
25.3kDa

Original price was: $370.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Asp20–Ser247 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Putative trypsinogen(try)

Product name Putative trypsinogen(try)
Uniprot ID C6L245
Uniprot link https://www.uniprot.org/uniprot/C6L245
Expression system Eukaryotic expression
Raw Antigen Sequence DDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGENNIDVLEGDEQFIDAAKIIRHPKYNSWTLDNDILLIKLSSPAVLNSRVSTLALPSACAPAGTLCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGEITSNMVCAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKNRPGVYTKVCNYVDWIQQTIAANS
Molecular weight 25.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 6.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asp20-Ser247
Protein Accession BAH86994
Spec:Entrez GeneID 100525899
Spec:NCBI Gene Aliases TRY
NCBI Reference BAH86994
Aliases /Synonyms PRSS2
Reference PX-P4830
Note For research use only
Molecular Constructor
Asp20–Ser247 His
Product name Putative trypsinogen(try)
Uniprot ID C6L245
Uniprot link https://www.uniprot.org/uniprot/C6L245
Expression system Eukaryotic expression
Raw Antigen Sequence DDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGENNIDVLEGDEQFIDAAKIIRHPKYNSWTLDNDILLIKLSSPAVLNSRVSTLALPSACAPAGTLCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGEITSNMVCAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKNRPGVYTKVCNYVDWIQQTIAANS
Molecular weight 25.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 6.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asp20-Ser247
Protein Accession BAH86994
Spec:Entrez GeneID 100525899
Spec:NCBI Gene Aliases TRY
NCBI Reference BAH86994
Aliases /Synonyms PRSS2
Reference PX-P4830
Note For research use only
Molecular Constructor
Asp20–Ser247 His
Product name PX-P4830-1MG
Uniprot ID C6L245
Uniprot link https://www.uniprot.org/uniprot/C6L245
Expression system Eukaryotic expression
Raw Antigen Sequence DDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGENNIDVLEGDEQFIDAAKIIRHPKYNSWTLDNDILLIKLSSPAVLNSRVSTLALPSACAPAGTLCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGEITSNMVCAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKNRPGVYTKVCNYVDWIQQTIAANS
Molecular weight 25.3kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 6.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asp20-Ser247
Protein Accession BAH86994
Spec:Entrez GeneID 100525899
Spec:NCBI Gene Aliases TRY
NCBI Reference BAH86994
Aliases /Synonyms PRSS2
Reference PX-P4830
Note For research use only
Molecular Constructor
Asp20–Ser247 His

Putative trypsinogen(try)

There are no reviews yet.

Be the first to review “Putative trypsinogen(try)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products