Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monocyte differentiation antigen CD14(CD14)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08571

$250.00

50ug + 250 loyalty points
Met1–Ala83 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Monocyte differentiation antigen CD14(CD14)

Product name Monocyte differentiation antigen CD14(CD14)
Uniprot ID P08571
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala83
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein,CD14
Reference PX-P4644
Note For research use only
Molecular Constructor
Met1–Ala83 His
Product name Monocyte differentiation antigen CD14(CD14)
Uniprot ID P08571
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala83
Aliases /Synonyms Myeloid cell-specific leucine-rich glycoprotein,CD14
Reference PX-P4644
Note For research use only
Molecular Constructor
Met1–Ala83 His

Monocyte differentiation antigen CD14(CD14)

There are no reviews yet.

Be the first to review “Monocyte differentiation antigen CD14(CD14)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products