Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atibuclimab Biosimilar – Anti-CD14 mAb – Research Grade

  • PX-TA1811-50
  • Validated ELISA
Isotype:
IgG4, Kappa

Original price was: $126.00.Current price is: $100.00.

50ug 21% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

Product name PX-TA1811-50
Uniprot ID P08571
Species Homo Sapiens
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade
Uniprot ID P08571
Species Homo Sapiens
Raw Antigen Sequence MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Atibuclimab,,CD14,anti-CD14
Reference PX-TA1811
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

Atibuclimab Biosimilar – Anti-CD14 mAb – Research Grade: A Powerful Antibody for Targeting CD14 Atibuclimab Biosimilar, also known as Anti-CD14 monoclonal antibody (mAb), is a highly effective and specific therapeutic antibody that targets the CD14 protein. This biosimilar is produced using advanced recombinant DNA technology and has been extensively studied and proven to be a valuable tool in the treatment of various diseases.

Structure of Atibuclimab Biosimilar

Atibuclimab Biosimilar is a fully humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CD14 protein, while the constant region is responsible for mediating effector functions.

The amino acid sequence of Atibuclimab Biosimilar is identical to the sequence of the original anti-CD14 mAb, making it a highly specific and potent therapeutic agent.

Activity of Atibuclimab Biosimilar

The primary function of Atibuclimab Biosimilar is to bind to the CD14 protein, which is found on the surface of immune cells such as monocytes, macrophages, and dendritic cells. CD14 is a co-receptor for Toll-like receptors (TLRs) and plays a crucial role in the activation of the immune system in response to infection and inflammation.

By binding to CD14, Atibuclimab Biosimilar blocks the interaction between CD14 and TLRs, thereby inhibiting the activation of immune cells and reducing the production of pro-inflammatory cytokines. This mechanism of action makes Atibuclimab Biosimilar an effective treatment for diseases characterized by excessive inflammation, such as sepsis, rheumatoid arthritis, and Crohn’s disease.

Applications of Atibuclimab Biosimilar

Atibuclimab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various diseases. Its ability to target CD14 makes it a potential therapeutic option for conditions such as:

  • Sepsis: By blocking the activation of immune cells, Atibuclimab Biosimilar can help reduce the severity of sepsis and improve patient outcomes.
  • Rheumatoid arthritis: In rheumatoid arthritis, CD14 is overexpressed on the surface of synovial cells, contributing to the inflammatory response. Atibuclimab Biosimilar can inhibit this response and reduce joint inflammation.
  • Crohn’s disease: CD14 is also involved in the pathogenesis of Crohn’s disease, and Atibuclimab Biosimilar has shown promising results in reducing inflammation and improving symptoms in patients with this condition.

In addition to these applications, Atibuclimab Biosimilar is also being studied for its potential in treating other inflammatory and autoimmune diseases, as well as certain types of cancer.

Conclusion

Atibuclimab Biosimilar is a powerful antibody that targets the CD14 protein and has shown promising results in the treatment of various diseases. Its specific and potent activity makes it a valuable tool for researchers and clinicians in the fight against inflammation and other related conditions. With ongoing research and development, Atibuclimab Biosimilar has the potential to improve the lives of patients and contribute to the advancement of medical science.

SDS-PAGE for Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

SDS-PAGE for Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade binds to Human CD14 recombinant protein in ELISA Assay

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade binds to Human CD14 recombinant protein in ELISA Assay

Human CD14 recombinant protein(cat. No.PX-P6553) at 0.5µg/mL (100µL/well) can bind Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Atibuclimab Biosimilar - Anti-CD14 mAb - Research Grade

There are no reviews yet.

Be the first to review “Atibuclimab Biosimilar – Anti-CD14 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products