Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD14 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P08571
Molecular weight:
35.09 kDa

Original price was: $228.00.Current price is: $199.00.

50ug 13% OFF + 199 loyalty points
Fc Thr20–Ala83
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD14 recombinant protein

Human CD14 recombinant protein

Product name PX-P6553-100
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83
Product name PX-P6553-1MG
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83
Product name PX-P6553-50
Uniprot ID P08571
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYA
Molecular weight 35.09 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Ala83
Aliases /Synonyms CD14, Monocyte differentiation antigen CD14Myeloid cell-specific leucine-rich glycoprotein,
Reference PX-P6553
Molecular Constructor
Fc Thr20–Ala83

There are no reviews yet.

Be the first to review “Human CD14 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products