Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD42b recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P07359
Molecular weight:
32.26 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Met1–Thr282 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD42b recombinant protein

Human CD42b recombinant protein

Product name PX-P6531-100
Uniprot ID P07359
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Molecular weight 32.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr282
Aliases /Synonyms GP-Ib alpha, Antigen CD42b-alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Platelet glycoprotein Ib alpha chain, GP1BACD42b,
Reference PX-P6531
Molecular Constructor
Met1–Thr282 His
Product name PX-P6531-1MG
Uniprot ID P07359
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Molecular weight 32.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr282
Aliases /Synonyms GP-Ib alpha, Antigen CD42b-alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Platelet glycoprotein Ib alpha chain, GP1BACD42b,
Reference PX-P6531
Molecular Constructor
Met1–Thr282 His
Product name PX-P6531-50
Uniprot ID P07359
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT
Molecular weight 32.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr282
Aliases /Synonyms GP-Ib alpha, Antigen CD42b-alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Platelet glycoprotein Ib alpha chain, GP1BACD42b,
Reference PX-P6531
Molecular Constructor
Met1–Thr282 His

There are no reviews yet.

Be the first to review “Human CD42b recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products