Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human COL17A1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q9UMD9
Molecular weight:
37.72 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Glu490–Arg566 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human COL17A1 recombinant protein

Human COL17A1 recombinant protein

Product name PX-P6518-100
Uniprot ID Q9UMD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight 37.72 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu490-Arg566
Aliases /Synonyms COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference PX-P6518
Molecular Constructor
Glu490–Arg566 Fc
Product name PX-P6518-1MG
Uniprot ID Q9UMD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight 37.72 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu490-Arg566
Aliases /Synonyms COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference PX-P6518
Molecular Constructor
Glu490–Arg566 Fc
Product name PX-P6518-50
Uniprot ID Q9UMD9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight 37.72 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu490-Arg566
Aliases /Synonyms COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference PX-P6518
Molecular Constructor
Glu490–Arg566 Fc

There are no reviews yet.

Be the first to review “Human COL17A1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products