Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human LY6E recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q16553
Molecular weight:
36.82 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Leu21–Ser101 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human LY6E recombinant protein

Human LY6E recombinant protein

Product name PX-P6493-100
Uniprot ID Q16553
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Molecular weight 36.82 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu21-Ser101
Aliases /Synonyms Ly-6E, Retinoic acid-induced gene E protein, RIG-E, Stem cell antigen 2, SCA-2, Thymic shared antigen 1, TSA-1, LY6E, 9804, RIGE, SCA2, TSA1Lymphocyte antigen 6E,
Reference PX-P6493
Molecular Constructor
Leu21–Ser101 Fc
Product name PX-P6493-1MG
Uniprot ID Q16553
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Molecular weight 36.82 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu21-Ser101
Aliases /Synonyms Ly-6E, Retinoic acid-induced gene E protein, RIG-E, Stem cell antigen 2, SCA-2, Thymic shared antigen 1, TSA-1, LY6E, 9804, RIGE, SCA2, TSA1Lymphocyte antigen 6E,
Reference PX-P6493
Molecular Constructor
Leu21–Ser101 Fc
Product name PX-P6493-50
Uniprot ID Q16553
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Molecular weight 36.82 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu21-Ser101
Aliases /Synonyms Ly-6E, Retinoic acid-induced gene E protein, RIG-E, Stem cell antigen 2, SCA-2, Thymic shared antigen 1, TSA-1, LY6E, 9804, RIGE, SCA2, TSA1Lymphocyte antigen 6E,
Reference PX-P6493
Molecular Constructor
Leu21–Ser101 Fc

Human LY6E recombinant protein

There are no reviews yet.

Be the first to review “Human LY6E recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products