Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD239 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P50895
Molecular weight:
16.53 kDa

Original price was: $400.00.Current price is: $327.00.

100ug 18% OFF + 327 loyalty points
Glu32–Glu148 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD239 recombinant protein

Human CD239 recombinant protein

Product name PX-P6521-100
Uniprot ID P50895
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPE
Molecular weight 16.53 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu32-Glu148
Aliases /Synonyms LU, MSK19, Auberger B antigen, CD239, Lutheran blood group glycoprotein, Lutheran antigen, F8/G253 antigen, B-CAM cell surface glycoprotein, BCAMBasal cell adhesion molecule,
Reference PX-P6521
Molecular Constructor
Glu32–Glu148 His
Product name PX-P6521-1MG
Uniprot ID P50895
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPE
Molecular weight 16.53 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu32-Glu148
Aliases /Synonyms LU, MSK19, Auberger B antigen, CD239, Lutheran blood group glycoprotein, Lutheran antigen, F8/G253 antigen, B-CAM cell surface glycoprotein, BCAMBasal cell adhesion molecule,
Reference PX-P6521
Molecular Constructor
Glu32–Glu148 His
Product name PX-P6521-50
Uniprot ID P50895
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPE
Molecular weight 16.53 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu32-Glu148
Aliases /Synonyms LU, MSK19, Auberger B antigen, CD239, Lutheran blood group glycoprotein, Lutheran antigen, F8/G253 antigen, B-CAM cell surface glycoprotein, BCAMBasal cell adhesion molecule,
Reference PX-P6521
Molecular Constructor
Glu32–Glu148 His

There are no reviews yet.

Be the first to review “Human CD239 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products