Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TDGF1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P13385
Molecular weight:
18.93 kDa

Original price was: $408.00.Current price is: $330.00.

50ug 19% OFF + 330 loyalty points
Leu31–Thr172 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human TDGF1 recombinant protein

Human TDGF1 recombinant protein

Product name PX-P6578-100
Uniprot ID P13385
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 18.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu31-Thr172
Aliases /Synonyms Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGFCripto-1 growth factor,
Reference PX-P6578
Molecular Constructor
Leu31–Thr172 His
Product name PX-P6578-1MG
Uniprot ID P13385
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 18.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu31-Thr172
Aliases /Synonyms Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGFCripto-1 growth factor,
Reference PX-P6578
Molecular Constructor
Leu31–Thr172 His
Product name PX-P6578-50
Uniprot ID P13385
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Molecular weight 18.93 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu31-Thr172
Aliases /Synonyms Teratocarcinoma-derived growth factor 1, TDGF1, CRIPTO, Epidermal growth factor-like cripto protein CR1, CRGFCripto-1 growth factor,
Reference PX-P6578
Molecular Constructor
Leu31–Thr172 His

SDS-PAGE for Human TDGF1 recombinant protein

SDS-PAGE for Human TDGF1 recombinant protein

Human TDGF1 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Human TDGF1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products