Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Rat Resistin-like alpha(Retnla) |
---|---|
Uniprot ID | Q99P85 |
Uniprot link | https://www.uniprot.org/uniprot/Q99P85 |
Origin species | Rattus norvegicus (Rat) |
Expression system | Eukaryotic expression |
Sequence | MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS |
Molecular weight | 35-40kDa |
Protein delivered with Tag? | C-terminal Fc Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | Tris-glycine |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Ser111 |
Protein Accession | Q99P85 |
Spec:Entrez GeneID | 81712 |
Spec:NCBI Gene Aliases | Himf |
NCBI Reference | Q99P85 |
Aliases /Synonyms | Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha |
Reference | PX-P4554 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.